PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_06690.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 341aa    MW: 39162.6 Da    PI: 7.0899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_06690.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.92e-5391381129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeel+++yLkkk++ +k+e+ evi+evd++k+ePwdL++++k     ++ewyfFs++d+ky+tg+r+nrat++g+W
  Rsa1.0_06690.1_g00001.1   9 VPPGFRFHPTDEELLHYYLKKKISYHKFEM-EVIREVDLNKLEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATHAGFW 93 
                              69****************************.99**************964444222455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk + + + +++g++ktLvfykgrap+g+ktdW+mheyrle
  Rsa1.0_06690.1_g00001.1  94 KATGRDKCIRN-TYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                              **********9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-608160IPR003441NAC domain
PROSITE profilePS5100558.1089160IPR003441NAC domain
PfamPF023658.4E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGSSSNGGVP PGFRFHPTDE ELLHYYLKKK ISYHKFEMEV IREVDLNKLE PWDLQERCKI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATHA GFWKATGRDK CIRNTYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDA DDSQGNSSED GWVVCRVFMK KNLFKVVTEG GSSINSTDHY  180
NHDASNNTNT LQARSFMHRD SPYQLVRNHG ATTFELNKPE LTLHQYPPIF HKPPSLGFDY  240
SSELPRDCES AASEGLQYQQ ACEPGLEVGT CDIVASHNHQ QGLGEWSMMD RLVTCHMGNE  300
DSSRGIRFED GNNNSSSVVQ PVPETNQLTL RSEMDFWGYS K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-53916217167NO APICAL MERISTEM PROTEIN
1ut4_B4e-53916217167NO APICAL MERISTEM PROTEIN
1ut7_A4e-53916217167NO APICAL MERISTEM PROTEIN
1ut7_B4e-53916217167NO APICAL MERISTEM PROTEIN
3swm_A4e-53916220170NAC domain-containing protein 19
3swm_B4e-53916220170NAC domain-containing protein 19
3swm_C4e-53916220170NAC domain-containing protein 19
3swm_D4e-53916220170NAC domain-containing protein 19
3swp_A4e-53916220170NAC domain-containing protein 19
3swp_B4e-53916220170NAC domain-containing protein 19
3swp_C4e-53916220170NAC domain-containing protein 19
3swp_D4e-53916220170NAC domain-containing protein 19
4dul_A4e-53916217167NAC domain-containing protein 19
4dul_B4e-53916217167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1336810.0AY133681.1 Arabidopsis thaliana clone C103095 putative NAM/NAP (At4g10350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009134191.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9SV870.0BRN2_ARATH; Protein BEARSKIN2
TrEMBLM4C9310.0M4C931_BRARP; Uncharacterized protein
STRINGBra000709.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.10.0NAC domain containing protein 70